• Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

Biology Research Paper-Gigantism is a condition characterized by abnormal or excessive growth and height significantly above average

Extracts from this document...

Introduction

´╗┐Cherno Okafor Aida Stefani SBI4U November 10th, 2012 Gigantism is a condition characterized by abnormal or excessive growth and height significantly above average. It is divided into two parts: cerebral gigantism and pituitary gigantism. Cerebral gigantism occurs in the absence of increased levels of growth hormone, attributed to a cerebral defect; infants are large, and accelerated growth continues for the first 4 or 5 years, the rate being normal thereafter. The hands and feet are large, the head is large, narrow and long, and the eyes have an antimongoloid slant with an abnormally wide space between them. The child is clumsy, and mental retardation of varying degree is usually present. On the other hand, pituitary gigantism, in humans, is caused by over-production or secretion of the growth hormone in childhood before the long bone epiphyses (growth plates) close resulting in persons between 7 feet (2.13m) and 9 feet (2.74m) in height. The term is typically applied to those whose height is not just in the upper 1% of the population but several standard deviations above mean for persons of the same sex, age, and ethnic ancestry. ...read more.

Middle

It may also lead to low levels of cortisol, estradiol (girls), testosterone (boys), and thyroid hormone. Some of the symptoms associated with gigantism involve: delayed puberty, double vision or difficulty with side (peripheral vision), frontal bossing and a prominent jaw and forehead, headaches and visual disturbances and nausea caused by the tumor pressing on the brain and nerves to the eyes, increased sweating, irregular periods (menstruation), large hands and feet with thick fingers and toes, release of breast milk, thickening of other facial features, and weakness along with hypertension, hoarseness, and joint pain. The treatment for gigantism varies. In pituitary tumors with well-defined borders, surgery is the treatment of choice and can cure many cases. For situations in which surgery cannot completely remove the tumor, medication is the treatment of choice. The most effective medications are somatostatin analogs (such as octreotide or long-acting lanreotide), which reduce the growth hormone release. Dopamine agonists (bromocriptine mesylate, cabergoline) have also been used to reduce growth hormone release, but these are generally less effective. ...read more.

Conclusion

Screening for complications of gigantism is required. Height and overall size can affect mobility due to muscle weakness, osteoarthritis and peripheral nerve damage. Everyday activities can be affected such as buying homes, furniture, cars, clothes and shoes as they are made for ?average-sized people?. Some psychological problems may also be caused by this very rare condition. Reduction of growth hormone levels improve life expectancy to normal levels, significantly improving symptoms and prevent most of the associated complications. Left untreated, gigantism is associated with significant complications and an increased death rate of around twice the normal average for the population. In summary, the differential diagnosis of gigantism includes a significant number of heterogeneous disorders exhibiting a staggering array of clinical and genetic features. In most cases, the history, physical examination and adjunctive biochemical and/or molecular genetic testing will ultimately reveal the likely diagnosis. Albeit rare, diseases resulting in gigantism afford the unique opportunity for a glimpse into the complex mechanisms of growth regulation. Thus, continued clinical and scientific investigation will enhance not only individual patient care, but also collective insight into the intricacies of the fundamental processes of human growth. ...read more.

The above preview is unformatted text

This student written piece of work is one of many that can be found in our International Baccalaureate Biology section.

Found what you're looking for?

  • Start learning 29% faster today
  • 150,000+ documents available
  • Just £6.99 a month

Not the one? Search for your essay title...
  • Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

See related essaysSee related essays

Related International Baccalaureate Biology essays

  1. Environmental Factors affecting plant growth

    This shows that the plants grew very slowly even after the supply of all the minerals. Evaluation Most of the results that I achieved do not support my hypothesis. They suggest that the deficiency of phosphorus leads to healthy plant growth which is something that I am not sure about.

  2. Independent Research Project Vital Lung Capacity

    airways; some individuals might have only minor symptoms and other might have much more major symptoms. When the actual airways are swollen, air must travel through the esophagus in a much smaller and tighter manner hence, depending on the state of severity of asthma, the vital capacity can limited to those whom are afflicted with asthma.

  1. cell theory summary

    This is called magnification. To calculate magnification: using a ruler measure the size of a large clear feature on the image Measure the same length on the specimen convert to the same units of measurement * Magnification = measured length of the image /measured length of the specimen * Length of the actual specimen = length on the image/ magnification ( e.g.

  2. Molecular Genetics: differentiating between various molecular databases

    Hamsters (Cricetidae) Number of AA in Beta chain 51 51 Amino Acid Sequence FVNQHLCGSHLVEALYLVCGNDGFFYRPKAGIVDQCCTGVCSLYQLQNYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKSGIVDQCCTSICSLYQLENYCN Aligned Sequence 10 20 30 40 50 FVNQHLCGSHLVEALYLVCGNDGFFYRPKAGIVDQCCTGVCSLYQLQNYCN ::::::::::::::::::::. :::: ::.::::::::..::::::.:::: FVNQHLCGSHLVEALYLVCGERGFFYTPKSGIVDQCCTSICSLYQLENYCN 10 20 30 40 50 % Identity 86.3% identity (96.1% similar) in 51 aa overlap Number of similar AA pairs (:)

  1. Allelopathy. Open Investigation Will increasing the number of allelopathic sunflower plants effect the ...

    Variables Independent variables - The number of sunflower seeds planted alongside the bean seed - 1 bean seed (control) - 1 bean seed + 1 sunflower seed - 1 bean seed + 2 sunflower seeds - 1 bean seed + 3 sunflower seeds - 1 bean seed + 4 sunflower

  2. Carrot growth with differing wavelegnths of light

    ATP synthase lets the protons cross the membrane by going down the proton gradient and uses the energy to synthesize ATP (Allot 2007). Remember, that entire process is dependent on the amount of light energy absorbed. Research Question: How does the wavelength of light affect the growth of Daucus carota?

  1. IB Genetic Unit Notes

    It is sex linked, the genes controlling the production of the blood proteins concerned are located on the X chromosome. It is caused by a recessive allele. Like colour blindness, it affects the male population considerably more than the female population.

  2. Comparing the effect of different antimicrobials on the growth of E.coli

    Dependent variable The diameter of the zone of inhibition that formed around the filter paper discs. The zones of inhibition become visible as the chemical in the discs dissolves into the culture medium (depending on the solubility and molecular size of the substance).

  • Over 160,000 pieces
    of student written work
  • Annotated by
    experienced teachers
  • Ideas and feedback to
    improve your own work