• Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

Comparing the effect of different antimicrobials on the growth of E.coli

Extracts from this document...

Introduction

´╗┐Comparing the effect of different antimicrobials on the susceptibility of Escherichia coli by measuring the diameter of the zone of inhibition Biology Laboratory Report IV Standard Level ________________ Comparing the effect of different antimicrobials on the susceptibility of Escherichia coli by measuring the diameter of the zones of inhibition ________________ Background information ?Antimicrobial is the name for a chemical that either kills or prevents the growth of microbes ('bugs' or 'germs') such as bacteria, viruses, fungi or protozoa. Some antimicrobials are produced by bugs themselves (e.g. penicillin is produced by the penicillium mould), others are designed in the laboratory. Different bugs are susceptible to different antimicrobials e.g. the penicillium mould is not killed by the penicillin it produces, but some bacteria are susceptible to penicillin.?[1] This experiment is based on the Kirby-Bauer Antimicrobial Susceptibility Test. ?The Kirby Bauer test is a qualitative assay whereby discs of paper are impregnated with a single concentration of different antibiotics. The discs are placed on the surface of an agar plate that has been inoculated with test bacteria. During incubation, the antibiotics diffuse outward from the discs creating a concentration gradient. After 18-24 hours, the zone diameter (zone of inhibition) is measured and reference tables are used to determine if the bacteria are Sensitive (S), Intermediate (I) or Resistant (R) to the antimicrobial drugs.?[2] ?Ampicillin belongs to a class of antibiotics called penicillins that are used for treating bacterial infections.?[3] Penicillins ?stop bacteria from multiplying by preventing bacteria from forming the walls that surround them. The walls are necessary to protect bacteria from their environment and to keep the contents of the bacterial cell together. Bacteria cannot survive without a cell wall. Penicillins are most effective when bacteria are actively multiplying and forming cell walls. Ampicillin is effective against many bacteria including H. influenzae, N. gonorrhoea, E. coli, Salmonella, and Shigella, streptococci and certain strains of staphylococci.?[4] Kanamycin is ?a water-soluble broad-spectrum antibiotic obtained from the soil bacterium Streptomyces kanamyceticus.?[5] It ?acts by inhibiting the synthesis of ...read more.

Middle

the zones of inhibition for all substances and for all concentrations were measured. The produced data was processed. Data The data obtained form the experiment was processed so that an average could be found. An average diameter was found for the zones of inhibition of each concentration of each antibiotic, so the comparison between the antibiotics would be valid. An average is found by adding together all of the elements (all diameters of the zones of inhibition of a specific concentration of a specific substance) and dividing the sum by the number of all elements. The formula for finding arithmetic average is . ________________ Table 1: The diameters and average diameters of the zones of inhibition created by different concentrations of the antibiotics Kanamycin, Ampicillin and Tetracycline in millimetres ( mm)[8] Diameter of the zones of inhibition in millimetres (mm) Antibiotic Concentration (µg/ml) 50 100 125 150 300 500 1000 Kanamycin Trial 1 - 16 18 18 19 20 22 Trial 2 - 11 15 16 16 18 20 Trial 3 - 15 16 15 20 21 20 Trial 4 - 13 15 15 16 16 19 Trial 5 - 15 18 18 19 20 22 Trial 6 - 18 18 19 21 22 21 Average diameter of the zones of inhibition in millimetres ( mm) - 14.7 16.7 16.8 18.5 19.5 20.6 Ampicillin Trial 1 - 0 0 0 0 0 0 Trial 2 - 0 0 0 0 0 0.7 Trial 3 - 0 0 0 0 0 0.9 Trial 4 - 0 0 0 0 0 0.8 Average diameter of the zones of inhibition in millimetres ( mm) - 0 0 0 0 0 0.6 Tetracycline Trial 1 11 11 12 13 18 19 - Trial 2 10 11 12 15 17 19 - Trial 3 9 11 12 13 16 18 - Trial 4 9 10 12 13 17 20 - Trial 5 10 12 14 14 17 20 - Trial 6 8 10 11 12 15 18 - Average diameter of the zones of inhibition in millimetres ( mm) ...read more.

Conclusion

and between the two other antimicrobials (% of saline solution) separately. This rises the question of the purpose of adding a disinfectant and a stain remover into the experiment alongside with the three antibiotics as no valid comparisons could be made between all of the five substances. In order to avoid this error in the future, all of the concentrations of the substances should be given in equivalent, or at least in comparable units. Another complication arose when some of the zones of inhibition on the petri dishes had merged together and were therefore slightly more difficult to measure. However, this probably did not significantly confound the results as the diameter of the zone of inhibition could be measured from another angel so that the value obtained was still valid. Regardless, for avoiding this potential obstacle in the future, the impregnated filter paper discs should be placed onto the bacterial culture so that the zones of inhibition would not merge. This can be done either by using larger petri dishes, placing a smaller number of impregnated filter paper discs on one petri dish, or reducing the concentrations of the substances the filter paper discs were impregnated with. ________________ [1] City eHealth Research Centre. ?What are Antimicrobials?? Bugs and Drugs on the Web. National Electronic Library of Infection Antimicrobial Resistance Website, 7 January 2004. Web. 17 May 2011. < http://www.neli.org.uk/arfaqs.nsf/c142977c99209f3680256c91003fdf4a/ 11ce1a253cf38dfc80256ca9005d32f9?OpenDocument> [2] Sockett, D. C., Valley, A. ?Antimicrobial Susceptibility Testing,? 14 April 2006. Web. 20 May 2011. <http://www.wvdl.wisc.edu/PDF/WVDL.Info.Antimicrobial_Susceptibility_Testing_at_WVDL.pdf> [3] Ogbru, O. ?Ampicillin, Omnipen, Polycillin, Principen.? MedicineNet.com. Web. 6 March 2012. <http://www.medicinenet.com/ampicillin/article.htm> [4] Ibid. [5] The American Heritage Medical Dictionary. ?Kanamycin.? The Free Dictionary by Farlex: Medical Dictionary. Web. 6 March 2012. <http://medical-dictionary.thefreedictionary.com/kanamycin> [6] Mosby's Dental Dictionary. ?Kanamycin.? The Free Dictionary by Farlex: Medical Dictionary. Web. 6 March 2012. <http://medical-dictionary.thefreedictionary.com/kanamycin> [7] Ogbru, O. ?Tetracycline, Sumycin.? MedicineNet.com. Web. 6 March 2012. <http://www.medicinenet.com/ampicillin/article.htm> [8] ?-? no data was obtained. [9] ?-? no data was obtained. ...read more.

The above preview is unformatted text

This student written piece of work is one of many that can be found in our International Baccalaureate Biology section.

Found what you're looking for?

  • Start learning 29% faster today
  • 150,000+ documents available
  • Just £6.99 a month

Not the one? Search for your essay title...
  • Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

See related essaysSee related essays

Related International Baccalaureate Biology essays

  1. Environmental Factors affecting plant growth

    One of the other problems that I faced could be managing the tubes in order. Every time after we took results, I had to take care the tubes were placed in the same position as before because if they weren't then it wouldn't have been possible to conduct a fair test.

  2. The effect of antibacterial toothpastes on Micrococcus luteus

    How data should be recorded Two diameters should be considered in the calculation since this gives more accurate results in calculating the difference between the two sets of data and also the variation within one set of data. Data should be recorded in a data table, so that the exact numbers of recorded data are presented.

  1. The effect of toliet cleaning products on E-coli ...

    However this process of replication is highly susceptible to mutation (Daviddarling, pg 1, 2008). The growth of bacterial cells can be inhibited by two processes. The first by cellular death (that the bacteria is literally killed by substance e.g. arsenic causes the cell membrane/wall to breakdown resulting in osmotic implosion).

  2. Molecular Genetics: differentiating between various molecular databases

    Hamsters (Cricetidae) Number of AA in Beta chain 110 51 Amino Acid Sequence MALWMHLLTVLALLALWGPNTGQAFVSRHLCGSNLVETLYSVCQDDGFFYIPKDRRELEDPQVEQTELGMGLGAGGLQPLALEMALQKRGIVDQCCTGTCTRHQLQSYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKSGIVDQCCTSICSLYQLENYCN Aligned Sequence 10 20 30 40 50 60 MALWMHLLTVLALLALWGPNTGQAFVSRHLCGSNLVETLYSVCQDDGFFYIPKDRRELEDPQVEQ ::..:::::.:::.:: :: . :::: ::. FVNQHLCGSHLVEALYLVCGERGFFYTPKS----------- 10 20 30 70 80 90 100 110 TELGMGLGAGGLQPlALEMALQKRGIVDQCCTGTCTRHQLQSYCN ::::::::.

  1. What is the effect of different body positions i.e. lying down, sitting and standing ...

    Data Collection: Qualitative Data: Table 1: Qualitative results taken when participants were in three different positions (lying down, sitting down, standing up) Participant Age (years) Gender Lying down Sitting down Standing up 1 16 Female * Talked a little bit * legs straight * Relaxed * laughed * Relaxed *

  2. Effect of Incandescent, Fluorescent and LED lights at 900 lumens on the concentration of ...

    The first 55 mL of ascorbic acid solution will directly be titrated. This is done to obtain an initial concentration value in order to compare upcoming results influenced by light. 4. Make sure burette knob of the titration apparatus is closed and then pour the 55 ml of ascorbic acid solution in the burette.

  1. Environmental Mangement - Upland Burning in Ireland and the Effects of the Heritage Bill ...

    The initial hazard-reduction burn requires exacting conditions of humidity, wind, and temperature to insure objectives will be achieved and safety measures are adhered too (Nugent, n.d.). Prescribed fires also remove the residue from logging practices, controls disease, maintain natural succession of flora communities, and reduce the need for herbicide and pesticide use.

  2. What is the effect of pH levels on the net production, given by the ...

    % DO Saturation (+/- 10%) (Avg.) 100% 90% 110% 100% 140% Note: Temperature was found to be at 230C +/- 10C for all 25 readings in Chlorella pyernoidosa BOD bottle samples both in closed system (air) but 250C when taking temperature of solution outside inside closed system.

  • Over 160,000 pieces
    of student written work
  • Annotated by
    experienced teachers
  • Ideas and feedback to
    improve your own work