• Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

Comparing the effect of different antimicrobials on the growth of E.coli

Extracts from this document...

Introduction

´╗┐Comparing the effect of different antimicrobials on the susceptibility of Escherichia coli by measuring the diameter of the zone of inhibition Biology Laboratory Report IV Standard Level ________________ Comparing the effect of different antimicrobials on the susceptibility of Escherichia coli by measuring the diameter of the zones of inhibition ________________ Background information ?Antimicrobial is the name for a chemical that either kills or prevents the growth of microbes ('bugs' or 'germs') such as bacteria, viruses, fungi or protozoa. Some antimicrobials are produced by bugs themselves (e.g. penicillin is produced by the penicillium mould), others are designed in the laboratory. Different bugs are susceptible to different antimicrobials e.g. the penicillium mould is not killed by the penicillin it produces, but some bacteria are susceptible to penicillin.?[1] This experiment is based on the Kirby-Bauer Antimicrobial Susceptibility Test. ?The Kirby Bauer test is a qualitative assay whereby discs of paper are impregnated with a single concentration of different antibiotics. The discs are placed on the surface of an agar plate that has been inoculated with test bacteria. During incubation, the antibiotics diffuse outward from the discs creating a concentration gradient. After 18-24 hours, the zone diameter (zone of inhibition) is measured and reference tables are used to determine if the bacteria are Sensitive (S), Intermediate (I) or Resistant (R) to the antimicrobial drugs.?[2] ?Ampicillin belongs to a class of antibiotics called penicillins that are used for treating bacterial infections.?[3] Penicillins ?stop bacteria from multiplying by preventing bacteria from forming the walls that surround them. The walls are necessary to protect bacteria from their environment and to keep the contents of the bacterial cell together. Bacteria cannot survive without a cell wall. Penicillins are most effective when bacteria are actively multiplying and forming cell walls. Ampicillin is effective against many bacteria including H. influenzae, N. gonorrhoea, E. coli, Salmonella, and Shigella, streptococci and certain strains of staphylococci.?[4] Kanamycin is ?a water-soluble broad-spectrum antibiotic obtained from the soil bacterium Streptomyces kanamyceticus.?[5] It ?acts by inhibiting the synthesis of ...read more.

Middle

the zones of inhibition for all substances and for all concentrations were measured. The produced data was processed. Data The data obtained form the experiment was processed so that an average could be found. An average diameter was found for the zones of inhibition of each concentration of each antibiotic, so the comparison between the antibiotics would be valid. An average is found by adding together all of the elements (all diameters of the zones of inhibition of a specific concentration of a specific substance) and dividing the sum by the number of all elements. The formula for finding arithmetic average is . ________________ Table 1: The diameters and average diameters of the zones of inhibition created by different concentrations of the antibiotics Kanamycin, Ampicillin and Tetracycline in millimetres ( mm)[8] Diameter of the zones of inhibition in millimetres (mm) Antibiotic Concentration (µg/ml) 50 100 125 150 300 500 1000 Kanamycin Trial 1 - 16 18 18 19 20 22 Trial 2 - 11 15 16 16 18 20 Trial 3 - 15 16 15 20 21 20 Trial 4 - 13 15 15 16 16 19 Trial 5 - 15 18 18 19 20 22 Trial 6 - 18 18 19 21 22 21 Average diameter of the zones of inhibition in millimetres ( mm) - 14.7 16.7 16.8 18.5 19.5 20.6 Ampicillin Trial 1 - 0 0 0 0 0 0 Trial 2 - 0 0 0 0 0 0.7 Trial 3 - 0 0 0 0 0 0.9 Trial 4 - 0 0 0 0 0 0.8 Average diameter of the zones of inhibition in millimetres ( mm) - 0 0 0 0 0 0.6 Tetracycline Trial 1 11 11 12 13 18 19 - Trial 2 10 11 12 15 17 19 - Trial 3 9 11 12 13 16 18 - Trial 4 9 10 12 13 17 20 - Trial 5 10 12 14 14 17 20 - Trial 6 8 10 11 12 15 18 - Average diameter of the zones of inhibition in millimetres ( mm) ...read more.

Conclusion

and between the two other antimicrobials (% of saline solution) separately. This rises the question of the purpose of adding a disinfectant and a stain remover into the experiment alongside with the three antibiotics as no valid comparisons could be made between all of the five substances. In order to avoid this error in the future, all of the concentrations of the substances should be given in equivalent, or at least in comparable units. Another complication arose when some of the zones of inhibition on the petri dishes had merged together and were therefore slightly more difficult to measure. However, this probably did not significantly confound the results as the diameter of the zone of inhibition could be measured from another angel so that the value obtained was still valid. Regardless, for avoiding this potential obstacle in the future, the impregnated filter paper discs should be placed onto the bacterial culture so that the zones of inhibition would not merge. This can be done either by using larger petri dishes, placing a smaller number of impregnated filter paper discs on one petri dish, or reducing the concentrations of the substances the filter paper discs were impregnated with. ________________ [1] City eHealth Research Centre. ?What are Antimicrobials?? Bugs and Drugs on the Web. National Electronic Library of Infection Antimicrobial Resistance Website, 7 January 2004. Web. 17 May 2011. < http://www.neli.org.uk/arfaqs.nsf/c142977c99209f3680256c91003fdf4a/ 11ce1a253cf38dfc80256ca9005d32f9?OpenDocument> [2] Sockett, D. C., Valley, A. ?Antimicrobial Susceptibility Testing,? 14 April 2006. Web. 20 May 2011. <http://www.wvdl.wisc.edu/PDF/WVDL.Info.Antimicrobial_Susceptibility_Testing_at_WVDL.pdf> [3] Ogbru, O. ?Ampicillin, Omnipen, Polycillin, Principen.? MedicineNet.com. Web. 6 March 2012. <http://www.medicinenet.com/ampicillin/article.htm> [4] Ibid. [5] The American Heritage Medical Dictionary. ?Kanamycin.? The Free Dictionary by Farlex: Medical Dictionary. Web. 6 March 2012. <http://medical-dictionary.thefreedictionary.com/kanamycin> [6] Mosby's Dental Dictionary. ?Kanamycin.? The Free Dictionary by Farlex: Medical Dictionary. Web. 6 March 2012. <http://medical-dictionary.thefreedictionary.com/kanamycin> [7] Ogbru, O. ?Tetracycline, Sumycin.? MedicineNet.com. Web. 6 March 2012. <http://www.medicinenet.com/ampicillin/article.htm> [8] ?-? no data was obtained. [9] ?-? no data was obtained. ...read more.

The above preview is unformatted text

This student written piece of work is one of many that can be found in our International Baccalaureate Biology section.

Found what you're looking for?

  • Start learning 29% faster today
  • 150,000+ documents available
  • Just £6.99 a month

Not the one? Search for your essay title...
  • Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

See related essaysSee related essays

Related International Baccalaureate Biology essays

  1. What is the effect of different body positions i.e. lying down, sitting and standing ...

    a chair for support in order to increase the reliability of the results The leg position of the participants when lying down and sitting down varied for each part and from experiment to experiment which would have influenced the blood pressure The leg position of the participants varied for each

  2. Environmental Factors affecting plant growth

    One of the other problems that I faced could be managing the tubes in order. Every time after we took results, I had to take care the tubes were placed in the same position as before because if they weren't then it wouldn't have been possible to conduct a fair test.

  1. The effect of antibacterial toothpastes on Micrococcus luteus

    Hands should be washed after handling the agar plates. The working area should be cleaned after the experiment. Environmental impact The experiment does not have a significantly negative impact on the environment. . The bacteria should be sterilised to make safe after the experiment, so that it would not be in direct contact with living organisms.

  2. The effect of toliet cleaning products on E-coli ...

    However this process of replication is highly susceptible to mutation (Daviddarling, pg 1, 2008). The growth of bacterial cells can be inhibited by two processes. The first by cellular death (that the bacteria is literally killed by substance e.g. arsenic causes the cell membrane/wall to breakdown resulting in osmotic implosion).

  1. Allelopathy. Open Investigation Will increasing the number of allelopathic sunflower plants effect the ...

    The size of seeds planted Seeds will the same of very similar size will be used in this experiment. Broken seeds will be neglected. The materials used to collect data The same 30cm plastic ruler will be used throughout the experiment to measure the size of the leaves and the

  2. Molecular Genetics: differentiating between various molecular databases

    65 % of total 65/110 = 59.1% Table 5: Comparing Chinchilla and Hamster Species Chinchilla (Chinchilla Brevicaudata) Hamsters (Cricetidae) Number of AA in Beta chain 86 51 Amino Acid Sequence FVNKHLCGSHLVDALYLVCGDRGFFYTPMAXXELEDPQVGQADPGVVPEAGRLQPLALEM TLQXXGIVDQCCTSICTLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKSGIVDQCCTSICSLYQLENYCN Aligned Sequence 10 20 30 40 50 60 FVNKHLCGSHLVDALYLVCGDRGFFYTPMAXXELEDPQVGQADPGVVPEAGRLQPLALEMTLQXX :::.::::::::.:::::::.::::::: .

  1. The effect of pvc piping on the breathing/heart rates of male year 12 students

    This experiment will examine at what length of pipe both breathing and heart rates are optimized without crossing these thresholds. Since straws are relatively limiting in length, adaptable PVC piping can be used as a substitute. 1.2.1 Controlling variables (table 1)

  2. What is the effect of pH levels on the net production, given by the ...

    Beaker should be filled slowly and slanted in order to prevent excessive O2 trapping. Fill up 5, 150mL BOD bottles with 130 mL +/- 5 mL of pH 8 buffer solution (Potassium Phosphate-Sodium Hydroxide (these 5 bottles will be the control group with pH of environment phytoplankton sample was found in).

  • Over 160,000 pieces
    of student written work
  • Annotated by
    experienced teachers
  • Ideas and feedback to
    improve your own work