• Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

Ecological studies of rice (Oryzae Sativa) populations

Extracts from this document...

Introduction

Practical 13: Ecological studies of rice (Oryzae Sativa) populations Hypothesis There is a significant difference in the lengths of the rice in the two different populations of Oryzae Sativa. Raw and Processed Data Table 1: Uncertainties of apparatus used in the experiment. Apparatus Uncertainties Vernier Calliper ±0.01cm Table 2: Formulae and sample calculations involved in processing data in the experiment. Calculations Formula Sample Calculation Mean ( ) Where, 1. refers to the total number of values. 2. ∑ refers to the addition of all values starting with the first value, denoted by = 1, and ending off with the last value, denoted by . 3. refers to the values in sequence from = 1 to the nth term or last term. Mean length of rice grains from population A: cm Standard Deviation ( ) Where, 1. refers to the total number of values. 2. ∑ refers to the addition of all values starting with the first value, denoted by = 1, and ending off with the last value -denoted by 3. refers to the frequency of that exact term being calculated. 4. refers to the square of the term, denoted by , subtracted by the mean value of the terms, denoted by . Standard Deviation for length of 30 rice grains from population A: T-test ( t ) Where, 1. and are the mean values for the first and second populations respectively. ...read more.

Middle

A t-test can also be used to find out whether the lengths of the rice grains from the two different populations are significantly different. The t value for the data is 18.1, which is considerably higher than that of the critical value of 2.001 given in the probability table for 58 degrees of freedom at a significance level of 95%. This means that there is a significant difference between the two data sets from the two populations; i.e. there is a significant difference in the lengths of the rice grains from the two populations. Hence, we can reject the null hypothesis; that there is no significant difference between the lengths of rice grains from the two populations. We can also conclude that the aforementioned hypothesis is true. The significant difference in the mean length of a rice grain from population A and B is due to polygenic inheritance. It is also the cause of the natural variation in length of the rice grains within the same population. Inheritance of quantitative traits or polygenic inheritance refers to the inheritance of a phenotypic characteristic that varies in degree and can be attributed to the interactions between two or more genes and their environment.[1] The polygenic model makes the following 6 assumptions[2]; 1. Each contributing gene has small and relatively equal effects. ...read more.

Conclusion

This could be done by bringing small sacks of rice and choosing from there, rather than from a small container. 2. A grain grader could also have been used to ensure that all the rice grains used in the experiment were not damaged. This will help to increase the precision of the values as well as the accuracy. Step 3: Measure the length of each of the 30 grains to the nearest 0.005 mm and record the length using a vernier calliper. 1. The vernier calliper is very big compared to the rice grain and hence it is difficult to use it to measure the length of the rice grain, as applying too much pressure may damage the rice grain, affecting the observed value, and also it was very tedious putting the rice grain between the teeth of the vernier calliper. 2. Also, the only characteristic measured in the experiment was grain length. This limited the study to only one phenotype and does not conclusively show whether there is a significant difference in the rice grains from the two populations. 1. A micrometer screw gauge could be used instead. It is more suited for small items like rice and hence will also provide more accurate readings. 2. Other visual characteristics, such as mass, and grain texture could have been compared so as to give further examples of the presence of quantitative distribution as well as making the comparison between the two populations more conclusive. ...read more.

The above preview is unformatted text

This student written piece of work is one of many that can be found in our International Baccalaureate Biology section.

Found what you're looking for?

  • Start learning 29% faster today
  • 150,000+ documents available
  • Just £6.99 a month

Not the one? Search for your essay title...
  • Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

See related essaysSee related essays

Related International Baccalaureate Biology essays

  1. The Effects of Salinity on Wheat Germination

    been germinated and grown in potting mix as opposed to on the paper towels also due to the fact that there may have residual chemicals remaining in the paper towel from the bleaching, most likely mild acids and tannins that may have affected germination however this was not apparent in the results.

  2. Lion King-The Ecological study

    The scarcity of trees often is caused by the lack of water which is true because the rainfall is seasonal. Most of the rainfalls fall into one or several months of a season. In the summer the temperature ranges from 78� to 86� F (25� - 30� C).

  1. Human variation

    All of the students were teenagers of age 16. Therefore they have not attained their maximum growth and therefore their maximum hand span and height. The majority of people stop growing at the age of 18. Below this age the rate of growth varies and is dependent on different factors.

  2. IB Genetic Unit Notes

    * Involved mostly in stem cell research. * Human embryos are produced and allowed to grow for a few days in order to obtain a small ball of cells that are not yet specialised. * SCNT is used the cells grow into any of a large number of different specialised tissues.

  1. Yeast Population

    Repeat steps 2-11, until you get all the results. Diagram Data Collection Table: The count of the yeast population of each beaker and trial after 24 hours. Data Table Showing the Change of Yeast Population in 24 Hours with Various Amounts of Sugar in Grams, � 0.1g Sugar/Trials 1 2 3 4 5 Avg.

  2. Lung Capacity Fitness Level

    / 60kg / 170cm 24.11 / Refect / 8:26am 23 High 1. -2.82 / 2.50 2. -2.61 / 2.50 3. -2.71 / 2.04 = 5.32 = 5.11 = 4.75 9 15 / 62kg / 175cm 24.11 / Refect / 8:20am 25 Ex high 1.

  1. Molecular Genetics: differentiating between various molecular databases

    Hamsters (Cricetidae) Number of AA in Beta chain 51 51 Amino Acid Sequence FVNQHLCGSHLVEALYLVCGNDGFFYRPKAGIVDQCCTGVCSLYQLQNYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKSGIVDQCCTSICSLYQLENYCN Aligned Sequence 10 20 30 40 50 FVNQHLCGSHLVEALYLVCGNDGFFYRPKAGIVDQCCTGVCSLYQLQNYCN ::::::::::::::::::::. :::: ::.::::::::..::::::.:::: FVNQHLCGSHLVEALYLVCGERGFFYTPKSGIVDQCCTSICSLYQLENYCN 10 20 30 40 50 % Identity 86.3% identity (96.1% similar) in 51 aa overlap Number of similar AA pairs (:)

  2. Biology Internal Assessment - investigate whether the Window and Notching caterpillar share the same ...

    than the mean distance from the midrib of the cabbage tree leaf to the nearest point of the notched feeding sites at 9mm. The error bars were calculated to show one standard deviation either side of the mean, displaying where 68% of the data lay.

  • Over 160,000 pieces
    of student written work
  • Annotated by
    experienced teachers
  • Ideas and feedback to
    improve your own work