• Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

Ecological studies of rice (Oryzae Sativa) populations

Extracts from this document...

Introduction

Practical 13: Ecological studies of rice (Oryzae Sativa) populations Hypothesis There is a significant difference in the lengths of the rice in the two different populations of Oryzae Sativa. Raw and Processed Data Table 1: Uncertainties of apparatus used in the experiment. Apparatus Uncertainties Vernier Calliper ±0.01cm Table 2: Formulae and sample calculations involved in processing data in the experiment. Calculations Formula Sample Calculation Mean ( ) Where, 1. refers to the total number of values. 2. ∑ refers to the addition of all values starting with the first value, denoted by = 1, and ending off with the last value, denoted by . 3. refers to the values in sequence from = 1 to the nth term or last term. Mean length of rice grains from population A: cm Standard Deviation ( ) Where, 1. refers to the total number of values. 2. ∑ refers to the addition of all values starting with the first value, denoted by = 1, and ending off with the last value -denoted by 3. refers to the frequency of that exact term being calculated. 4. refers to the square of the term, denoted by , subtracted by the mean value of the terms, denoted by . Standard Deviation for length of 30 rice grains from population A: T-test ( t ) Where, 1. and are the mean values for the first and second populations respectively. ...read more.

Middle

A t-test can also be used to find out whether the lengths of the rice grains from the two different populations are significantly different. The t value for the data is 18.1, which is considerably higher than that of the critical value of 2.001 given in the probability table for 58 degrees of freedom at a significance level of 95%. This means that there is a significant difference between the two data sets from the two populations; i.e. there is a significant difference in the lengths of the rice grains from the two populations. Hence, we can reject the null hypothesis; that there is no significant difference between the lengths of rice grains from the two populations. We can also conclude that the aforementioned hypothesis is true. The significant difference in the mean length of a rice grain from population A and B is due to polygenic inheritance. It is also the cause of the natural variation in length of the rice grains within the same population. Inheritance of quantitative traits or polygenic inheritance refers to the inheritance of a phenotypic characteristic that varies in degree and can be attributed to the interactions between two or more genes and their environment.[1] The polygenic model makes the following 6 assumptions[2]; 1. Each contributing gene has small and relatively equal effects. ...read more.

Conclusion

This could be done by bringing small sacks of rice and choosing from there, rather than from a small container. 2. A grain grader could also have been used to ensure that all the rice grains used in the experiment were not damaged. This will help to increase the precision of the values as well as the accuracy. Step 3: Measure the length of each of the 30 grains to the nearest 0.005 mm and record the length using a vernier calliper. 1. The vernier calliper is very big compared to the rice grain and hence it is difficult to use it to measure the length of the rice grain, as applying too much pressure may damage the rice grain, affecting the observed value, and also it was very tedious putting the rice grain between the teeth of the vernier calliper. 2. Also, the only characteristic measured in the experiment was grain length. This limited the study to only one phenotype and does not conclusively show whether there is a significant difference in the rice grains from the two populations. 1. A micrometer screw gauge could be used instead. It is more suited for small items like rice and hence will also provide more accurate readings. 2. Other visual characteristics, such as mass, and grain texture could have been compared so as to give further examples of the presence of quantitative distribution as well as making the comparison between the two populations more conclusive. ...read more.

The above preview is unformatted text

This student written piece of work is one of many that can be found in our International Baccalaureate Biology section.

Found what you're looking for?

  • Start learning 29% faster today
  • 150,000+ documents available
  • Just £6.99 a month

Not the one? Search for your essay title...
  • Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

See related essaysSee related essays

Related International Baccalaureate Biology essays

  1. Lion King-The Ecological study

    In a Savanna the temperature does not change a lot. When it does, it is very gradual and not drastic. Animals that inhabit savannahs are usually mammals, herbivores in exact, such as rhino, giraffes, elephants and carnivores such as lions, cheetahs, leopards....The ecosystem can be divertive but it all mainly depends on the amount of water that is available.

  2. Yeast Population

    Time: Since we are measuring the yeast population, I had set a certain limit of time, which was 24 hours. By making it 24 hours, I had the same given time for each trial, making the result as accurate as possible. Apparatus, Quantity 500mL Beaker (6)

  1. Molecular Genetics: differentiating between various molecular databases

    Chinchilla (Chinchilla Brevicaudata) Number of AA in Beta chain 51 86 Amino Acid Sequence FVNQHLCGSHLVEALYLVCGNDGFFYRPKAGIVDQCCTGVCSLYQLQNYCN FVNKHLCGSHLVDALYLVCGDRGFFYTPMAXXELEDPQVGQADPGVVPEAGRLQPLALEM TLQXXGIVDQCCTSICTLYQLENYCN Aligned Sequence 10 20 30 FVNQHLCGSHLVEALYLVCGNDGFFYRPKA----------------------------------- :::.::::::::.:::::::. :::: : : FVNKHLCGSHLVDALYLVCGDRGFFYTPMAXXELEDPQVGQADPGVVPEAGRLQPLALEMTLQXX 10 20 30 40 50 60 40 50 GIVDQCCTGVCSLYQLQNYCN ::::::::..:.::::.:::: GIVDQCCTSICTLYQLENYCN 70 80 % Identity 45.8% identity (54.2% similar)

  2. Human variation

    However there are some anomalies present in the scatter graph such as a hand span of 22.4�1cm and height of 169.5�2cm.

  1. Environmental Mangement - Upland Burning in Ireland and the Effects of the Heritage Bill ...

    A firebreak is first established through a line-backing fire along the downwind side of the target area. Successive lines of spot fires are then set along the upwind side of the backing fire until the entire area has been covered.

  2. Comparing the Sexy Sons Hypothesis and the Pathogen Avoidance Models Effects on Sexual Selection

    This is possibly because with a lack of females, each female is viewed as more ?valuable? and thus paternity with multiple females may have too big of a time expended/risk to reward ratio as competition will be extreme. This leads to males that are more fit to mate with the

  1. Biology Internal Assessment - investigate whether the Window and Notching caterpillar share the same ...

    tree leaf to the nearest point of the feeding site from notched and window shaped feeding sites on cabbage tree leaves. Graph showing the mean distance from the midrib of the cabbage tree leaf to the nearest point of the feeding site (mm)

  2. Examine the correlation between soil moisture at different heights up the slope and the ...

    The soil moisture probe must be left in the soil for at least 30 seconds in order to allow the reading to stop fluctuating. The reading on the probe should thus then be recorded at 30 seconds. This measurement should be repeated 3 times in the exact same place so

  • Over 160,000 pieces
    of student written work
  • Annotated by
    experienced teachers
  • Ideas and feedback to
    improve your own work