• Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

Genetic engineering has been a controversial topic

Extracts from this document...

Introduction

´╗┐Chris Yim 11.6 Biology 1/4/201 Ms. Leggett Genetic engineering has been an controversial topic due to the many sides that it has an impact on. Some say that genetic engineering can aid the environment, since genes could be manipulated in trees to absorb more CO2 to reduce the threat of global warming[1]- while others ( also in some religious beliefs) ) think that the humans should not have the right to manipulate the laws and course of nature. In this essay, I will contrast the overall impact it has brought upon society and come to a conclusion. The definition of genetic engineering ( also known as genetic modification ) is ?the alteration of genetic code by artificial means, which is different compared to from traditional selective breeding? [2]. Genetic engineering as the direct manipulation of DNA by humans outside breeding and mutations has only existed since the 1970s. The key event to modern genetic engineering began in the 1970s when(1972) Paul Berg created the first recombinant DNA molecules, and when (1973) Herbert Boyer and Stanley Cohen created the first transgenic organism by inserting antibiotic resistance genes into the plasmid of an E. coli bacterium. Genetic engineering is a complicated procedure which is divided into 7 steps; Isolation the gene, Construction, Gene targeting, Transformation, Selection, Regeneration and Confirmation. The gene to be inserted into the genetically modified organism must be chosen and isolated for identification. ...read more.

Middle

surrounding availability of genetic information, which basically answers the Social Concerns Arising from the New Genetics.[4] Genetic modified foods?s effect on the economy is also notable. Genetic modified foods include crops, vegetables and fruit that have been created using genetic engineering methods. They are more productive and have a larger yield while also offering more nutritional value and better flavor[5], which means it has an advantage over natural foods.The fact that they are more productive means that it is more quantitative compared to natural foods, meaning it would lower the food prices ( for countries that has genetically modified foods), which ( in the long term) would indefinitely balance the wealth spread between the rich and the poor. As of 2006, 252 million acres of genetically modified crops are planted in 22 countries by 10.3 million farmers, which indicates the influence of genetic engineering.[6] Some have even suggested that genetically modified foods is a possible solution for world hunger ( though this theory is not entirely correct since statistics show that it is the political system which disarrays the distribution of food in the world ).The drawback of Genetic modified foods is that it requires high maintenance and regulation from the government to ensure the safety of the foods. Another main concern is that genetically modified foods has unknown effects on human health[7], since the processing of introducing a gene to plants may cause unexpected results- which means that genetically modified foods are still not completely reliable. ...read more.

Conclusion

Buzzle Web Portal: Intelligent Life on the Web. Retrieved April 4, 2011, from http://www.buzzle.com/articles/genetically-modified-foods-advantages-and-dangers.html -Baxamusa, B. N. (n.d.). Genetic Engineering in Humans. Buzzle Web Portal: Intelligent Life on the Web. Retrieved April 5, 2011, from http://www.buzzle.com/articles/genetic-engineering-in-humans.html -7 Genetically Modified Foods: Harmful or Helpful?. (n.d.). ProQuest. Retrieved April 4, 2011, from http://www.csa.com/discoveryguides/gmfood/overview.php ________________ [1] Genetic Engineering Advantages & Disadvantages - Biology Online. (n.d.). Life Science Reference - Biology Online. Retrieved April 4, 2011, from http://www.biology-online.org/2/13_genetic_engineering.htm [2] Genetic Engineering: What Is Genetic Engineering?. (n.d.). globalchange.com. Retrieved April 4, 2011, from http://www.globalchange.com/geneticengin.htm [3] What is gene therapy? - Genetics Home Reference. (n.d.). Genetics Home Reference - Your guide to understanding genetic conditions. Retrieved April 4, 2011, from http://ghr.nlm.nih.gov/handbook/therapy/genetherapy [4] Ethical, Legal, and Social Issues --Genome Research. (n.d.). Oak Ridge National Laboratory. Retrieved April 4, 2011, from http://www.ornl.gov/sci/techresources/Human_Genome/elsi/elsi.shtml [5] Panse, . (n.d.). The Advantages and Disadvantages of Genetically Modified Food: A Look at the Pros and Cons of GM Food. Find Health, Education, Science & Technology Articles, Reviews, How-To and Tech Tips At Bright Hub - Apply To Be A Writer Today!. Retrieved April 4, 2011, from http://www.brighthub.com/science/genetics/articles/23358.aspx [6] -K, M. (n.d.). Genetically Modified Foods: Advantages and Dangers. Buzzle Web Portal: Intelligent Life on the Web. Retrieved April 4, 2011, from http://www.buzzle.com/articles/genetically-modified-foods-advantages-and-dangers.html [7] Genetically Modified Foods: Harmful or Helpful?. (n.d.). ProQuest. Retrieved April 4, 2011, from http://www.csa.com/discoveryguides/gmfood/overview.php [8] -Baxamusa, B. N. (n.d.). Genetic Engineering in Humans. Buzzle Web Portal: Intelligent Life on the Web. Retrieved April 5, 2011, from http://www.buzzle.com/articles/genetic-engineering-in-humans.html [9] Effects of Genetic Engineering. (n.d.). Disabled World. Retrieved April 4, 2011, from www.disabled-world.com/artman/publish/genetic-engineering.shtml ...read more.

The above preview is unformatted text

This student written piece of work is one of many that can be found in our International Baccalaureate Biology section.

Found what you're looking for?

  • Start learning 29% faster today
  • 150,000+ documents available
  • Just £6.99 a month

Not the one? Search for your essay title...
  • Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

See related essaysSee related essays

Related International Baccalaureate Biology essays

  1. IB Genetic Lab

    of females, and that there is a clear association between the two factors2. This error can be improved in the future by increasing the sample size. This could be done by surveying more females to ensure that a solid conclusion can be drawn from numerous amounts of recorded values, and to increase the reliability of the experiment.

  2. extended essay

    This is possible because it is based upon the theory that each nucleus present in every cell of an adult organism is believed to contain the entire genetic complement of that organism. This meaning that the nucleus found within the intestinal cell is genetically identical to that of a fertilized egg that helped the upbringing of that specific adult.

  1. Independent Research Project Vital Lung Capacity

    is known that males have higher vital capacities that females do, and a majority of either gender would affect the results. Lastly and most importantly, it was extremely imperative to make sure that no participant was enduring any asthmatic attack during their data recording.

  2. Molecular Genetics: differentiating between various molecular databases

    65 % of total 65/110 = 59.1% Table 5: Comparing Chinchilla and Hamster Species Chinchilla (Chinchilla Brevicaudata) Hamsters (Cricetidae) Number of AA in Beta chain 86 51 Amino Acid Sequence FVNKHLCGSHLVDALYLVCGDRGFFYTPMAXXELEDPQVGQADPGVVPEAGRLQPLALEM TLQXXGIVDQCCTSICTLYQLENYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKSGIVDQCCTSICSLYQLENYCN Aligned Sequence 10 20 30 40 50 60 FVNKHLCGSHLVDALYLVCGDRGFFYTPMAXXELEDPQVGQADPGVVPEAGRLQPLALEMTLQXX :::.::::::::.:::::::.::::::: .

  1. Lung Capacity Fitness Level

    / 65kg / 175cm 24.11 / EST 2 / 2:00pm 24 High 1. -2.80 / 2.02 2. -3.26 / 1.52 3. -2.28 / 1.50 = 4.86 = 4.78 = 3.78 12 15 / 65kg / 175cm 24.11 / EST 2 / 2:00pm 22 Medium 1.

  2. IB Genetic Unit Notes

    4.2.4: Explain that non-disjunction can lead to changes in chromosome number, illustrated by reference to Down syndrome (trisomy 21). Non-disjunction is the term for the failure of a pair of chromatids to separate and go to opposite poles during division of the nucleus.

  1. Gene Therapy

    Once the divisions have occurred, the new and improved tissues are inserted back into the affected area in the patient's body. In order to carry out these type of techniques, the doctors only require to culture the patient's bone marrow.

  2. Comparing the Sexy Sons Hypothesis and the Pathogen Avoidance Models Effects on Sexual Selection

    This study was helpful as previously stated, the purpose behind all life in an evolutionary perspective is to produce more offspring and the polyandrous lineage males were able to accomplish that goal. A more complete analysis was done in 2013 by Adam Nelson and 8 other researchers.

  • Over 160,000 pieces
    of student written work
  • Annotated by
    experienced teachers
  • Ideas and feedback to
    improve your own work