• Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

How does cooking affect the amount of vitamin C in lemon juice?

Extracts from this document...


´╗┐AHMAD LUTFI BIN MOHAMAD M08G Title: Measuring the concentration of vitamin C. Research Question: How does cooking affect the amount of vitamin C in lemon juice? Hypothesis: The longer the lemon juice is cooked up to the boiling temperature, the lower the concentration of vitamin C. Variables: 1. Independent: Type of lemon juice samples [fresh lemon juice (0 minute boiled) , 10 minutes boiled lemon juice, 1 hour boiled lemon juice]. 2. Dependent: The concentration of vitamin C. 3. Constant: 1. The volume of DCPIP solution used. In each trial, 1 cm3 of DCPIP solution is used. 1 cm3 is chosen because it is neither too much nor too little since too much DCPIP solution used will need high amount of lemon juice to decolourise. In fact, the volume needs to be fixed as different volume of DCPIP solution requires different volume of lemon juice to decolourise. 2. The volume of lemon juice used for dilution. 4 cm3 of each type of lemon juice is used to make up 100 cm3 solution. The volume must be constant as if different amount of lemon juice is used in the dilution, then there is no point of conducting the experiment since the data for each condition of lemon juice does not correspond and tally to each other. ...read more.


Hence: CjCs = 100%4% Cj = 25 × Cs Where Cs = 0.05 mg / volume of diluted lemon juice sample titrated. From the formula derived, the concentration of vitamin C in lemon juice sample (Cj) can now be calculated. Below is an example of calculation made to find the concentration of vitamin C in fresh lemon juice. Cj (fresh lemon juice) = 25 × 0.05 mg32.60 cm³ = 3.834 × 10-2 mg cm-3 Uncertainties: Percentage uncertainty of volume of diluted lemon juice titrated = 0.10 cm³32.60 cm³ ×100% = 0.307% Percentage uncertainty of DCPIP = 0.1 cm³1.0 cm³ ×100% = 10.0 % Total percentage uncertainty of the concentration of vitamin C in fresh lemon juice, = 0.307% + 10.0 % = 10.307% Therefore, the concentration of vitamin C = 3.834 × 10-2 mg cm-3 ± 10.31% in fresh lemon juice Hence, the concentration of vitamin C in all samples of lemon juices can be presented in the following table: Lemon Juice Sample Concentration of Vitamin C (×10-2 mg cm-3) Fresh lemon juice 3.834 ± 10.31% 10 minutes boiled lemon juice 3.030 ± 10.24% 1 hour boiled lemon juice 4.160 ± 10.33% Table 4 the concentration of vitamin C in different lemon juice samples. ...read more.


DCPIP is very sensitive to heat, thus the warm sample titrated into DCPIP will cause the DCPIP to decolourise faster. The sample should be left about 10 minutes for it to cool down before being used in the titration. This will ensure that the DCPIP is in optimal condition thus no other factor will cause it to decolourise faster other than because of the presence of ascorbic acid. The dilution of lemon juice samples is done in a 100 cm3 measuring cylinder. It is quite difficult to shake the solution inside a measuring cylinder (a step which is supposed to be done in dilution process) and the huge uncertainty of measuring cylinder could greatly affect the reliability of the data obtained. The dilution process should be done in a volumetric flask since it has a smaller uncertainty and the apparatus itself is invented and meant for dilution. The three lemon juice samples are prepared from different lemon fruits. Problems and inaccuracies might arise as different lemon fruits contain different concentration of vitamin C thus causes the data obtained to be defective. The lemon fruits should be prepared together. Then, all the lemon juice prepared should be mixed together before being separated into 3 samples. This will ensure that all the three samples have relatively the same. ...read more.

The above preview is unformatted text

This student written piece of work is one of many that can be found in our International Baccalaureate Biology section.

Found what you're looking for?

  • Start learning 29% faster today
  • 150,000+ documents available
  • Just £6.99 a month

Not the one? Search for your essay title...
  • Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

See related essaysSee related essays

Related International Baccalaureate Biology essays

  1. experiment vitamin C

    Dalam novel Tuan Gatsby karya Tennessee William, konflik ini ditonjolkan melalui watak Tom dan Tuan Gatsby itu sendiri. Hubungan antara Tom dan Gatsby amat dingin sehingga mereka jarang sekali bercakap antara satu sama lain walaupun mereka saling mengenali. Gatsby sebenarnya masih menyimpan perasaan sayangnya kepada Daisy yang telah meninggalkannya disebabkan tamak akan harta dan kemewahan.

  2. Vitamin C concentration

    Type of equipment- each measurement was carried out using the same apparatus. Example: the DCPIP solution was measured using only one same pipette throughout the experiment 4) State of the decolourisation- as the experiment bases visual aspects, one sample of decolourised DCPIP was used as the basic one and

  1. Research Question:- How does the time of boiling effect the amount of vitamin ...

    Throughout the experiment, the solution colour turns from blue to purple, purple to light purple and then colourless. > The smell of glacial acetic acid is pungent and its colour is colourless. Data Processing;- a. Calculation of volume of glacial acetic acid, lemon juice + distilled water needed for trial.

  2. Biology- Extended essay. For this research, I investigated the effects of DDT and ...

    The fish food was bought by from the same local fishery thus providing equal nutrients to all the fishes. (Crude Protein: 32%, Crude Fat: 45, Crude Fiber: 55, moisture: 10%) - As per the proximate analysis provided behind the cover of the food.

  1. The research is about four different orange juices. The hypothesis is that the homemade ...

    Vitamin C is an important vitamin, it has a lot of positive effects. Meanly sportsman need vitamin C. Because during the performance a lot of vitamin C is used by the convert from carbohydrate to energy. Vitamin C is also concerned with other things.

  2. Genes of fruit fly practical write up

    Wild type body and Ebony body Table 2.2.5 F1 WW WW ww Ww Ww ww Ww Ww F2 W w W WW Ww w Ww ww Table 2.2.6 Sex Phenotype observed hypothesis tested expected (E-O)2/E Level of Significance Male wild type 461 3 454 0.0821 0.5455 Female wild type 435

  1. Molecular Genetics: differentiating between various molecular databases

    Hamsters (Cricetidae) Number of AA in Beta chain 51 51 Amino Acid Sequence FVNQHLCGSHLVEALYLVCGNDGFFYRPKAGIVDQCCTGVCSLYQLQNYCN FVNQHLCGSHLVEALYLVCGERGFFYTPKSGIVDQCCTSICSLYQLENYCN Aligned Sequence 10 20 30 40 50 FVNQHLCGSHLVEALYLVCGNDGFFYRPKAGIVDQCCTGVCSLYQLQNYCN ::::::::::::::::::::. :::: ::.::::::::..::::::.:::: FVNQHLCGSHLVEALYLVCGERGFFYTPKSGIVDQCCTSICSLYQLENYCN 10 20 30 40 50 % Identity 86.3% identity (96.1% similar) in 51 aa overlap Number of similar AA pairs (:)

  2. The Effect of Temperature on the Vitamin C Content of Lemon Juice

    The error bars were calculated to show one standard deviation either side of the mean, displaying where 68% of the data lay. Mostly the error bars are small indication that my recorded values were all close to the mean therefore reliable.

  • Over 160,000 pieces
    of student written work
  • Annotated by
    experienced teachers
  • Ideas and feedback to
    improve your own work