• Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

Research Question: Does the influence of human beings, have an impact on the environmental gradient of species diversity found within Pruhonsky Haj?

Extracts from this document...

Introduction

ESS 11 2012 INTERNAL ASSESSMENT ESS Research Question: Does the influence of human beings, have an impact on the environmental gradient of species' diversity found within Pruhonsky Haj? Hypothesis: Due to modernization and urbanization being two common factors that humans ultimately bring along with their presence in a certain area, my prediction is set to believe that the gradient of diversity within Pruhonsky Haj, was negatively affected from the influence of humans. Null Hypothesis: Human presence in an area does not share a relationship with the environmental diversity, therefore it does not affect it. Variables[1]: Independent: Human impact (certainty) -This variable is changed as each observation changes, and when done so will affect the diversity. This variable is a factor of observation as explained in the Research Question. ...read more.

Middle

The default quad-rat that we use gives us a specific measurement, whereas a different device could potentially make the results different. Steps 1-8. Background: Climate is a crucial aspect when it comes to the diversity found within a certain area. The Czech Republic is a country with temperate weather- cool summers, cold, humid winters- The climate affects the diversity through aspects like precipitation, temperature, soil quality, and sunlight. When juxtaposed to other areas, Czech Republic should weigh in into medium zone in terms of quality of wildlife and ultimate diversity. The Czech Republic has a population total of 10,177,000 people spread across its lands, with 1/10th of them living inside the capital, Prague. 74% of the overall land has been urbanized by the people exploiting the territories, and modernizing towards societies definition of civilization. ...read more.

Conclusion

To measure using a quad-rat, plant your squared device on the ground. ii. Plot down how many different species you found in your quad-rat according to where you are on the human activity slope. In the end your graph should look something like this (results are for exemplary purposes only): 7. Now that you have your final results, compare each of your sections together (you should have 20). 8. Compare the change in diversity from your measurements as they go from one side of the slope to the other by seeing how the number of different species change as the slope changes. Sources cited: Factbook, CIA World. "Czech Republic." CIA World Factbook. US GOV, 20 Mar. 2012. Web. 26 Mar. 2012. <https://www.cia.gov/library/publications/ the-world-factbook/geos/ez.html>. [1] Very good listing and explaining! [2] You should normally add more than one Controlled variable. ...read more.

The above preview is unformatted text

This student written piece of work is one of many that can be found in our International Baccalaureate Biology section.

Found what you're looking for?

  • Start learning 29% faster today
  • 150,000+ documents available
  • Just £6.99 a month

Not the one? Search for your essay title...
  • Join over 1.2 million students every month
  • Accelerate your learning by 29%
  • Unlimited access from just £6.99 per month

See related essaysSee related essays

Related International Baccalaureate Biology essays

  1. Marked by a teacher

    Neurology and Behaviour. Focus question: Is there an increase in the perception and ...

    5 star(s)

    Which were that of a coffee stain, tape worm, acne scars, moss and a petri dish cookie. This is quite unusual to the expected results however it may be explained as the men had difficulty determing what some of the images were and as such may have rated them higher

  2. Ecology Open Investigation Does the geographic location affect the biotic and abiotic ...

    In this experiment the significance level is set at 5% or 0.05. In Tabel 3.2, the abiotic features that accepted the Null Hypothesis were the turbidity, nitrates and pH level of the two experiment sites. Other abiotic features that were also calculated in Table 3.2 were oxygen levels and temperature.

  1. Independent Research Project Vital Lung Capacity

    Maximum VC Trial in Milliliters (�0.1 liters) 1 1 2.1 2.3 2 2.1 3 2.3 2 1 1.9 2.3 2 2.3 3 2.1 3 1 3.0 3.0 2 2.9 3 3.0 4 1 2.8 2.9 2 2.9 3 1.9 5 1 3.2 3.3 2 3.3 3 3.3 Total Average: 2.76 ml Table 2: Each participant was asked

  2. Research Question (RQ) How does the position of the arm (cuff) in relation ...

    They were able to relax into this position and stand comfortably for the duration of these experimental trials. The subjects appeared to find this trial a lot easier and less tiring. Data Processing and Presentation: Table 3: The Total Average Systolic (SYS)

  1. Lung Capacity Fitness Level

    The t-test is a data analysis used to compare two sets of data and determine if the two sets of data are significantly and statistically the same of different. 'P' denotes Probability and the critical probability for this experiment is 0.05 or the equivalent, 5%.

  2. Penicillin - its discovery, properties and uses.

    It didn't help matters that in 1895, when the Italian Vicenzo Tiberio of Naples made an extract of penicillium mould and injected into the bloodstream of virulent animals, but the results were inconclusive. Two years later in France, Ernest Duchesne had completed his Ph.D. on the evolutionary competition among microorganisms.

  1. Simpson Diversity Lab

    6 - 16 dandelions (� 2) - 2 plantain (� 1) 7 - 11 dandelions (� 1) - 22 plantain (� 2) 8 - 10 dandelions (� 1) - 19 plantain (� 2) 9 - 13 dandelions (� 1) - 35 plantain (� 3) 10 - 17 dandelions (� 2)

  2. Molecular Genetics: differentiating between various molecular databases

    FVNKHLCGSHLVDALYLVCGDRGFFYTPMAXXELEDPQVGQADPGVVPEAGRLQPLALEMTLQXXGIVDQCCTSICTLYQLENYCN MALWMHLLTVLALLALWGPNTGQAFVSRHLCGSNLVETLYSVCQDDGFFYIPKDRRELEDPQVEQTELGMGLGAGGLQPLALEMALQKRGIVDQCCTGTCTRHQLQSYCN Aligned Sequence 10 20 30 40 50 FVNKHLCGSHLVDALYLVCGDRGFFYTPMAXXELEDPQVGQADPGVVPEAGRLQPL ::..:::::.::..:: :: : :::: : ::::::: :.. :. :: :::: MALWMHLLTVLALLALWGPNTGQAFVSRHLCGSNLVETLYSVCQDDGFFYIPKDRRELEDPQVEQTELGMGLGAGGLQPL 10 20 30 40 50 60 70 80 60 70 80 ALEMTLQXXGIVDQCCTSICTLYQLENYCN ::::.:: ::::::::. :: .::..::: ALEMALQKRGIVDQCCTGTCTRHQLQSYCN 90 100 110 % Identity 64.0 % identity (79.1 % similar)

  • Over 160,000 pieces
    of student written work
  • Annotated by
    experienced teachers
  • Ideas and feedback to
    improve your own work